Skip to content
Skillv1.0.0

fair-esm

Run the FAIR `fair-esm` package — the original Meta Fundamental AI Research reference implementation of the ESM family of protein language and structure models. Use this skill when: (1) Extracting per

by LiorZ(0) 0 installs
Free
Sign in to install

Free account. Installing gives you the manifest plus copy-paste snippets.

See reviews

About

Imported from LiorZ/protein-design-skills (skills/fair-esm/SKILL.md). Install upstream with npx skills add LiorZ/protein-design-skills --skill fair-esm. Copyright stays with the author (MIT).

fair-esm — FAIR's ESM / ESM-2 / ESMFold / ESM-IF / ESM-1v Reference Code

What this is

fair-esm (PyPI) / facebookresearch/esm (GitHub) is the reference PyTorch implementation of the entire ESM family of protein models from the Meta Fundamental AI Research Protein Team (FAIR). One pip install gives you every public model and four CLIs:

Model family Best checkpoint to start with What it does CLI / API
ESM-2 (PLM) esm2_t33_650M_UR50D (650M) ; scale to esm2_t36_3B_UR50D (3B) or esm2_t48_15B_UR50D (15B) for top quality Per-residue / per-sequence embeddings, attention contact maps, masked-LM scoring esm-extract CLI; model(tokens, repr_layers=[...], return_contacts=True)
ESMFold esmfold_v1 End-to-end single-sequence 3D structure prediction. ~88 mean pLDDT on the small example sequence. Multimer with :-separated chains. esm-fold -i in.fasta -o pdb_out; model.infer_pdb(seq)
ESM-IF1 (GVPTransformer) esm_if1_gvp4_t16_142M_UR50 (124M) Inverse folding / fixed-backbone sequence design from N / CA / C coordinates. 51 % native recovery, 72 % buried. Single-chain or multi-chain complex. Tolerates partially masked backbones (coords = np.inf). examples/inverse_folding/sample_sequences.py and score_log_likelihoods.py; model.sample(coords, temperature=T)
ESM-1v esm1v_t33_650M_UR90S_[1-5] (5-model ensemble) Zero-shot variant effect prediction on deep mutational scans. Three scoring strategies: wt-marginals, masked-marginals, pseudo-ppl. examples/variant-prediction/predict.py
MSA Transformer esm_msa1b_t12_100M_UR50S Per-residue embeddings + SOTA unsupervised contacts from an A3M multiple-sequence alignment. model(tokens); pass --msa-path to predict.py for variants
ESM-1b / ESM-1 esm1b_t33_650M_UR50S Predecessor PLMs — superseded by ESM-2 for most uses. Same API as ESM-2

fair-esm is in maintenance mode. The FAIR team's new code base is evolutionaryscale/esm (ESM-3 / ESM-C). For ESM-2 / ESMFold / ESM-IF / ESM-1v this repository is still the reference. For ESM-3 use the EvolutionaryScale package instead. Hugging Face's transformers library also re-implements ESM-1b / ESM-2 / ESMFold with a standardized API — see huggingface.co/docs/transformers/model_doc/esm.

When to use which model

Pick the smallest model that meets your accuracy bar — every step up in parameters costs roughly 4 × the memory and 2-4 × the time.

Task First choice Notes
One-shot structure prediction esmfold_v1 Single sequence, no MSA. ~1 GPU-second per residue at L≈400 on an A100. For higher accuracy on hard targets, switch to AlphaFold-Multimer / Chai-1 / Boltz-2.
Bulk structure prediction (≥ 1 k sequences) esm-fold CLI with --max-tokens-per-batch Sorts by length and batches. Use --cpu-offload to fit longer sequences on smaller GPUs.
Generic embeddings for ML downstream task esm2_t33_650M_UR50D, --include mean per_tok from final layer (33) 650M is the standard "good default". 15B is rarely worth it for transfer learning.
Contact prediction esm2_t33_650M_UR50D + return_contacts=True, or esm_msa1b_t12_100M_UR50S (better if you have an MSA) Requires regression weights — auto-downloaded for all models except ESM-1v and ESM-IF.
Inverse folding / fixed-backbone design esm_if1_gvp4_t16_142M_UR50 For higher experimental success, also try ProteinMPNN / SolubleMPNN — see binder-design.
Zero-shot variant effect ESM-1v 5-model ensemble + masked-marginals If you have an MSA, the MSA-Transformer + masked-marginals is often slightly better. ESM-2 also works well.
Search / browse ~770 M predicted metagenomic structures ESM Metagenomic Atlas (esmatlas.com) Folded with esmfold_v0 / esmfold_v1. Foldseek API available for structural search.

Three-step quick start

1) Install

# Core (ESM-2, ESM-1, ESM-1v, MSA-Transformer, ESM-IF model class)
pip install fair-esm

# With ESMFold (needs python <= 3.9 and CUDA `nvcc` for OpenFold)
pip install "fair-esm[esmfold]"
pip install 'dllogger @ git+https://github.com/NVIDIA/dllogger.git'
pip install 'openfold @ git+https://github.com/aqlaboratory/openfold.git@4b41059694619831a7db195b7e0988fc4ff3a307'

ESM-IF1 has its own conda recipe (because pytorch-geometric is finicky):

conda create -n inverse python=3.9
conda activate inverse
conda install pytorch cudatoolkit=11.3 -c pytorch
conda install pyg -c pyg -c conda-forge
pip install biotite fair-esm

Full details, including the environment.yml recipe and known-good PyTorch / CUDA / pyg combinations, are in references/installation.md.

2) Smoke test

import torch, esm
model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
model.eval()
batch_converter = alphabet.get_batch_converter()
_, _, toks = batch_converter([("p1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSL")])
with torch.no_grad():
    out = model(toks, repr_layers=[33], return_contacts=True)
print(out["representations"][33].shape)  # (1, L+2, 1280)
print(out["contacts"].shape)              # (1, L, L)

The first call downloads ~650 MB to ~/.cache/torch/hub/checkpoints/.

3) Run something real

Pick one based on what you actually want to do:

Want Run
Embeddings for a FASTA esm-extract esm2_t33_650M_UR50D seqs.fa out/ --repr_layers 33 --include mean per_tok
Structure for a FASTA esm-fold -i seqs.fa -o pdbs/
Sample 5 designs for chain C of target.pdb python examples/inverse_folding/sample_sequences.py target.pdb --chain C --num-samples 5 --temperature 1 --outpath out.fasta
Score variant sequences against backbone python examples/inverse_folding/score_log_likelihoods.py target.pdb variants.fa --chain C --outpath scores.csv
Label a DMS CSV with predictions python examples/variant-prediction/predict.py --model-location esm1v_t33_650M_UR90S_{1..5} --sequence <WT> --dms-input dms.csv --mutation-col mutant --dms-output dms_scored.csv --offset-idx <N> --scoring-strategy masked-marginals

What each reference page covers

  • references/installation.md — pip vs conda, CUDA / nvcc / OpenFold gotchas, the pyg dance for ESM-IF1, where weights cache, offline use.
  • references/models.md — every checkpoint, params / layers / embed-dim / dataset, regression-weight matrix (contacts), download URLs.
  • references/esm2-embeddings.mdesm-extract CLI, the --include {mean,per_tok,bos,contacts} flags, repr_layers, the saved .pt schema, truncation, batching by toks_per_batch.
  • references/esmfold-structure.mdesm-fold CLI, model.infer_pdb() / infer_pdbs(), multimer syntax (chain1:chain2), set_chunk_size, --cpu-offload FSDP path, output pLDDT / pTM extraction.
  • references/inverse-folding.md — ESM-IF1 end-to-end: load_structure / load_coords / extract_coords_from_complex, single-chain vs multi-chain, model.sample, score_sequence / score_sequence_in_complex, partial masking with np.inf, get_encoder_output for structural reps, and the sample_sequences.py / score_log_likelihoods.py CLIs.
  • references/variant-prediction.md — ESM-1v 5-model ensemble, wt-marginals / masked-marginals / pseudo-ppl scoring strategies, --offset-idx, A3M MSA ingestion for the MSA Transformer, output CSV schema.
  • references/msa-transformer.md — A3M / FASTA ingestion, remove_insertions, the 3-D token tensor shape (1, N, L), tied-row attention contacts.
  • references/contact-prediction.mdpredict_contacts / return_contacts, regression-weight requirement, MSA-Transformer contacts vs ESM-2 contacts, evaluation idioms.
  • references/atlas.md — ESM Metagenomic Atlas: api.esmatlas.com/foldSequence/v1/pdb/, metadata parquet / sqlite schema, bulk download with aria2c / s5cmd, structure search via Foldseek.
  • references/python-api.md — every public function/class that's safe to import: esm.pretrained.*, esm.Alphabet, esm.BatchConverter, esm.FastaBatchedDataset, esm.inverse_folding.util.*, esm.inverse_folding.multichain_util.*, the ESMFold .infer interface.
  • references/troubleshooting.md — common failure modes: missing regression weights, truncation_seq_length=1022, nvcc not found, pyg version mismatch, OOM, model.eval() for ESM-IF1, AA repetition in ESM-IF samples (EEEEEE...).

What each example does

examples/ mirrors the official examples/ plus a few extras:

  • extract_embeddings.py — minimal ESM-2 forward pass, save mean + per-tok representations.
  • bulk_extract.shesm-extract invocation pattern.
  • fold_single.py — load esmfold_v1, fold one sequence, print mean pLDDT, save PDB.
  • fold_bulk.shesm-fold invocation for bulk FASTA folding.
  • inverse_fold_sample.py — load ESM-IF1, sample N sequences for a target chain.
  • inverse_fold_multichain.py — multi-chain complex sequence design.
  • inverse_fold_score.py — score a list of variants against a fixed backbone.
  • inverse_fold_partial_mask.py — mask a span of backbone with np.inf and resample only that span.
  • inverse_fold_encoder_output.py — extract the L×512 structure representation.
  • variant_dms.sh — full 5-model ensemble DMS scoring command.
  • contact_prediction.py — extract attention-based contacts from ESM-2.
  • atlas_api.sh — fold a sequence via the public ESM Atlas API with curl.

All examples are short (≤ 60 lines), self-contained, and use the small esm2_t6_8M_UR50D (8 M) checkpoint where possible so they run on CPU in under a minute.

Most common traps (read this even if you skim the rest)

  1. model.eval() is mandatory for ESM-IF1 and recommended everywhere else. Forgetting it triggers dropout and you get worse samples / scores.
  2. truncation_seq_length=1022 is the default for esm-extract. ESM-2 was trained at length ≤ 1024 (BOS + L + EOS) — sequences past 1022 are silently truncated unless you raise this flag (memory permitting).
  3. BOS / EOS tokens wrap every sequence. When indexing the representations[layer] tensor, residue i is at position i+1. The extract.py recipe slices [1 : truncate_len + 1] for per-token reps.
  4. Contact prediction needs regression weights that are downloaded automatically — except for ESM-1v, ESM-IF, and partially-trained ESM-2 (-270K / -500K). On those models return_contacts=True does nothing useful.
  5. ESM-IF1 partial masking uses np.inf, not np.nan. Set coords[i:j, :, :] = np.inf to mark residues as having "missing backbone".
  6. Multimers in ESMFold are encoded as a single sequence with : between chains; the model inserts a length-25 poly-G linker by default (chain_linker="G" * 25) and offsets residue index by 512 (residue_index_offset=512). Override with the constructor / .infer() kwargs.
  7. ESM-IF1 sometimes outputs amino-acid repeats (e.g. EEEEEEEE). The official README explicitly recommends filtering these from sampled designs — don't trust them as-is.
  8. PyG / torch-scatter / CUDA mismatch is by far the most common ESM-IF1 install failure — see references/installation.md for the matrix. The recent commit 636becf ("guard torch_scatter dependency") makes the import lazy so the package itself imports without it, but ESM-IF1 sampling will still fail without it.
  9. 15B model + single GPU needs --cpu-offload (FSDP) — see examples/esm2_infer_fairscale_fsdp_cpu_offloading.py in the repo and references/esmfold-structure.md.
  10. Reproducibility: ESMFold has random masking inside .infer; if you need byte-exact reproducibility, seed torch.manual_seed and pass an explicit masking_pattern.

When not to use fair-esm

  • For ESM-3 / ESM-C → use the evolutionaryscale/esm package instead.
  • For HF-transformers-native pipelines (e.g. ESMFold inside a transformers Trainer or pipeline) → use the HF re-implementation.
  • For higher-accuracy multimer / antibody / protein-ligand structures → use AlphaFold-Multimer / Chai-1 / Boltz-2 (see chai, boltz, alphafold skills).
  • For high-success-rate binder design → ProteinMPNN-family models tend to outperform ESM-IF1 on experimental success, despite ESM-IF1's stronger in-silico sequence recovery (see binder-design).
  • For very long sequences (> ~2 k residues) without GPU offloading → AlphaFold-Multimer or chunked ESMFold with --chunk-size 64 / 32 / 16.

Reading order

If you're new, start with this SKILL.md, then jump straight to the one reference page that matches your task (esm2-embeddings.md, esmfold-structure.md, inverse-folding.md, or variant-prediction.md). Skim troubleshooting.md before you run anything large.

Use it

Copy one of these into your project. Installing also returns the manifest and these snippets.

yaml
targets:
  - https://api.opensmartroute.ai/api/v1/registry/liorz-protein-design-skills-fair-esm/manifest   # or paste the manifest below

Manifest

An Open Capability Manifest: the router reads it to know what this does, what it costs and when to pick it.

liorz-protein-design-skills-fair-esm.ocm.jsonjson
{
  "ocm": "1",
  "id": "liorz-protein-design-skills-fair-esm",
  "kind": "skill",
  "name": "fair-esm",
  "description": "Run the FAIR `fair-esm` package — the original Meta Fundamental AI Research reference implementation of the ESM family of protein language and structure models. Use this skill when: (1) Extracting per-residue or per-sequence embeddings from a protein language model (ESM-2 6 variants from 8M → 15B, ESM-1b, ESM-1v, ESM-MSA), (2) Predicting protein 3D structure end-to-end from a single sequence with **ESMFold** (`esm-fold` CLI or `model.infer_pdb()`), (3) Designing sequences for a fixed backbone — fixed-backbone (a.k.a. inverse-folding) sequence design with **ESM-IF1** (`GVPTransformer`, single-chain or multi-chain complex), (4) Scoring conditional log-likelihoods of candidate sequences against a backbone (variant ranking, design scoring, perplexity), (5) Zero-shot variant effect prediction on deep mutational scans with **ESM-1v** ensembles or ESM-MSA (wt-marginals, masked-marginals, pseudo-perplexity), (6) Unsupervised contact prediction from attention maps (`return_contacts=True` / `predict_contacts`), (7) Bul",
  "publisher": "LiorZ",
  "version": "1.0.0",
  "capabilities": {
    "domains": [
      "math"
    ],
    "tags": [
      "skill-md",
      "protein-language-model",
      "embeddings",
      "structure-prediction",
      "inverse-folding",
      "variant-effect",
      "contact-prediction",
      "esm2",
      "esmfold",
      "esm-if"
    ],
    "languages": [
      "en"
    ]
  },
  "quality_prior": 0.6,
  "examples": [
    "Run the FAIR `fair-esm` package — the original Meta Fundamental AI Research reference implementation of the ESM family of protein language and structure models. Use this skill when: (1) Extracting per-residue or per-sequence embeddings from a protein language model (ESM-2 6 variants from 8M → 15B, ESM-1b, ESM-1v, ESM-MSA), (2) Predicting protein 3D structure end-to-end from a single sequence with **ESMFold** (`esm-fold` CLI or `model.infer_pdb()`), (3) Designing sequences for a fixed backbone — fixed-backbone (a.k.a. inverse-folding) sequence design with **ESM-IF1** (`GVPTransformer`, single-chain or multi-chain complex), (4) Scoring conditional log-likelihoods of candidate sequences against a backbone (variant ranking, design scoring, perplexity), (5) Zero-shot variant effect prediction on deep mutational scans with **ESM-1v** ensembles or ESM-MSA (wt-marginals, masked-marginals, pseudo-perplexity), (6) Unsupervised contact prediction from attention maps (`return_contacts=True` / `predict_contacts`), (7) Bul"
  ],
  "primary": false,
  "metadata": {
    "source": {
      "provider": "github",
      "repository": "https://github.com/LiorZ/protein-design-skills",
      "path": "skills/fair-esm/SKILL.md",
      "ref": "19497c0277566fecb9249cfd3aae884c8d809f62",
      "url": "https://github.com/LiorZ/protein-design-skills/blob/19497c0277566fecb9249cfd3aae884c8d809f62/skills/fair-esm/SKILL.md",
      "key": "LiorZ/protein-design-skills/skills/fair-esm/SKILL.md"
    },
    "license": "MIT"
  },
  "instructions": "# fair-esm — FAIR's ESM / ESM-2 / ESMFold / ESM-IF / ESM-1v Reference Code\n\n## What this is\n\n`fair-esm` (PyPI) / `facebookresearch/esm` (GitHub) is the **reference\nPyTorch implementation** of the entire ESM family of protein models from the\nMeta Fundamental AI Research Protein Team (FAIR). One pip install gives you\nevery public model and four CLIs:\n\n| Model family | Best checkpoint to start with | What it does | CLI / API |\n|--------------|-------------------------------|--------------|-----------|\n| **ESM-2** (PLM) | `esm2_t33_650M_UR50D` (650M) ; scale to `esm2_t36_3B_UR50D` (3B) or `esm2_t4",
  "cost": {
    "context_tokens": 3260
  }
}

Fetch it by URL: GET /api/v1/registry/liorz-protein-design-skills-fair-esm/manifest?version=1.0.0

Reviews

Star ratings from people who tried it. One review per account; edit yours any time.

No reviews yet. Install it, try it, and be the first to rate it.